SCOPe 2.01: Domain d2c44d_: 2c44 D:

Lineage for d2c44d_ (2c44 D:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (25 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187268] (1 PDB entry)

8. Domain d2c44d_: 2c44 D: [146374]
   Other proteins in same PDB: d2c44a1
   automated match to d1ax4a_
   complexed with k, so4

Details for d2c44d_

PDB Entry: 2c44, 2.81 Å

PDB Description: crystal structure of e. coli tryptophanase

PDB Compounds: (D:) tryptophanase

SCOPe Domain Sequences for d2c44d_:

Sequence; same for both SEQRES and ATOM records:

>d2c44d_ c.67.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]}
khlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavtqsmq
aammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqekgld
rskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergieevg
pnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikqreae
ykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvvqegf
ptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaafvda
gkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrltipr
atytqthmdfiieafkhvkenasnikgltftyepkvlrhftaklkev

Timeline for d2c44d_:

• d2c44d_ first appeared in SCOP 1.75, called d2c44d1
  
• d2c44d_ appears in SCOPe 2.02
  
• d2c44d_ appears in the current release, SCOPe 2.08