Lineage for d2c44b1 (2c44 B:5-471)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 840449Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 840450Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) (S)
  5. 840776Family c.67.1.2: Beta-eliminating lyases [53397] (2 proteins)
  6. 840777Protein Tryptophan indol-lyase (tryptophanase) [53400] (2 species)
  7. 840778Species Escherichia coli [TaxId:562] [159703] (4 PDB entries)
    Uniprot P0A853 5-471! Uniprot Q8XB34 5-471
  8. 840783Domain d2c44b1: 2c44 B:5-471 [146372]
    automatically matched to 2C44 A:5-471
    complexed with k, so4

Details for d2c44b1

PDB Entry: 2c44 (more details), 2.8 Å

PDB Description: crystal structure of e. coli tryptophanase
PDB Compounds: (B:) tryptophanase

SCOP Domain Sequences for d2c44b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c44b1 c.67.1.2 (B:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]}
khlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavtqsmq
aammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqekgld
rskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergieevg
pnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikqreae
ykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvvqegf
ptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaafvda
gkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrltipr
atytqthmdfiieafkhvkenasnikgltftyepkvlrhftaklkev

SCOP Domain Coordinates for d2c44b1:

Click to download the PDB-style file with coordinates for d2c44b1.
(The format of our PDB-style files is described here.)

Timeline for d2c44b1: