Lineage for d2c39t1 (2c39 T:8-155)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 853223Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)
  6. 853224Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)
  7. 853232Species Sulfolobus solfataricus [TaxId:2287] [159924] (7 PDB entries)
    Uniprot Q9UXC2 8-155
  8. 853280Domain d2c39t1: 2c39 T:8-155 [146360]
    Other proteins in same PDB: d2c39a1, d2c39a2, d2c39b2, d2c39c1, d2c39c2, d2c39d2, d2c39e1, d2c39e2, d2c39f2, d2c39g1, d2c39g2, d2c39i1, d2c39i2, d2c39j2, d2c39k1, d2c39k2, d2c39l2, d2c39m1, d2c39m2, d2c39n2, d2c39o1, d2c39o2, d2c39p2, d2c39q1, d2c39q2, d2c39r2, d2c39s1, d2c39s2, d2c39t2, d2c39u1, d2c39u2, d2c39v2, d2c39w1, d2c39w2, d2c39x2
    automatically matched to 2BR2 B:8-155
    complexed with adp

Details for d2c39t1

PDB Entry: 2c39 (more details), 3.3 Å

PDB Description: rnase ph core of the archaeal exosome in complex with adp
PDB Compounds: (T:) probable exosome complex exonuclease 1

SCOP Domain Sequences for d2c39t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c39t1 d.14.1.4 (T:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
fteilqadagsrlvslmaaslaladagi

SCOP Domain Coordinates for d2c39t1:

Click to download the PDB-style file with coordinates for d2c39t1.
(The format of our PDB-style files is described here.)

Timeline for d2c39t1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c39t2
View in 3D
Domains from other chains:
(mouse over for more information)
d2c39a1, d2c39a2, d2c39b1, d2c39b2, d2c39c1, d2c39c2, d2c39d1, d2c39d2, d2c39e1, d2c39e2, d2c39f1, d2c39f2, d2c39g1, d2c39g2, d2c39i1, d2c39i2, d2c39j1, d2c39j2, d2c39k1, d2c39k2, d2c39l1, d2c39l2, d2c39m1, d2c39m2, d2c39n1, d2c39n2, d2c39o1, d2c39o2, d2c39p1, d2c39p2, d2c39q1, d2c39q2, d2c39r1, d2c39r2, d2c39s1, d2c39s2, d2c39u1, d2c39u2, d2c39v1, d2c39v2, d2c39w1, d2c39w2, d2c39x1, d2c39x2