Lineage for d2c39m2 (2c39 M:192-275)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920395Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1920396Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 1920397Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 1920459Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species)
  7. 1920473Species Sulfolobus solfataricus [TaxId:2287] [160599] (6 PDB entries)
    Uniprot Q9UXC0 192-275
  8. 1920485Domain d2c39m2: 2c39 M:192-275 [146347]
    Other proteins in same PDB: d2c39a1, d2c39b1, d2c39b2, d2c39c1, d2c39d1, d2c39d2, d2c39e1, d2c39f1, d2c39f2, d2c39g1, d2c39i1, d2c39j1, d2c39j2, d2c39k1, d2c39l1, d2c39l2, d2c39m1, d2c39n1, d2c39n2, d2c39o1, d2c39p1, d2c39p2, d2c39q1, d2c39r1, d2c39r2, d2c39s1, d2c39t1, d2c39t2, d2c39u1, d2c39v1, d2c39v2, d2c39w1, d2c39x1, d2c39x2
    automatically matched to 2JE6 A:192-275
    protein/RNA complex; complexed with adp

Details for d2c39m2

PDB Entry: 2c39 (more details), 3.3 Å

PDB Description: rnase ph core of the archaeal exosome in complex with adp
PDB Compounds: (M:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2c39m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c39m2 d.101.1.1 (M:192-275) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

SCOPe Domain Coordinates for d2c39m2:

Click to download the PDB-style file with coordinates for d2c39m2.
(The format of our PDB-style files is described here.)

Timeline for d2c39m2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c39m1
View in 3D
Domains from other chains:
(mouse over for more information)
d2c39a1, d2c39a2, d2c39b1, d2c39b2, d2c39c1, d2c39c2, d2c39d1, d2c39d2, d2c39e1, d2c39e2, d2c39f1, d2c39f2, d2c39g1, d2c39g2, d2c39i1, d2c39i2, d2c39j1, d2c39j2, d2c39k1, d2c39k2, d2c39l1, d2c39l2, d2c39n1, d2c39n2, d2c39o1, d2c39o2, d2c39p1, d2c39p2, d2c39q1, d2c39q2, d2c39r1, d2c39r2, d2c39s1, d2c39s2, d2c39t1, d2c39t2, d2c39u1, d2c39u2, d2c39v1, d2c39v2, d2c39w1, d2c39w2, d2c39x1, d2c39x2