Lineage for d2c38k1 (2c38 K:1-191)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401399Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1401400Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1401647Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 1401709Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species)
  7. 1401720Species Sulfolobus solfataricus [TaxId:2287] [159922] (9 PDB entries)
    Uniprot Q9UXC0 1-191
  8. 1401755Domain d2c38k1: 2c38 K:1-191 [146296]
    Other proteins in same PDB: d2c38a2, d2c38b1, d2c38b2, d2c38c2, d2c38d1, d2c38d2, d2c38e2, d2c38f1, d2c38f2, d2c38g2, d2c38h1, d2c38h2, d2c38i2, d2c38j1, d2c38j2, d2c38k2, d2c38l1, d2c38l2, d2c38m2, d2c38n1, d2c38n2, d2c38o2, d2c38p1, d2c38p2, d2c38q2, d2c38r1, d2c38r2, d2c38s2, d2c38t1, d2c38t2, d2c38u2, d2c38v1, d2c38v2, d2c38w2, d2c38x1, d2c38x2
    automatically matched to 2JE6 A:1-191
    protein/RNA complex; complexed with amp, cl

Details for d2c38k1

PDB Entry: 2c38 (more details), 3.1 Å

PDB Description: rnase ph core of the archaeal exosome in complex with a5 rna
PDB Compounds: (K:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2c38k1:

Sequence, based on SEQRES records: (download)

>d2c38k1 d.14.1.4 (K:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
svnknevvgkl

Sequence, based on observed residues (ATOM records): (download)

>d2c38k1 d.14.1.4 (K:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
nevvgkl

SCOPe Domain Coordinates for d2c38k1:

Click to download the PDB-style file with coordinates for d2c38k1.
(The format of our PDB-style files is described here.)

Timeline for d2c38k1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c38k2
View in 3D
Domains from other chains:
(mouse over for more information)
d2c38a1, d2c38a2, d2c38b1, d2c38b2, d2c38c1, d2c38c2, d2c38d1, d2c38d2, d2c38e1, d2c38e2, d2c38f1, d2c38f2, d2c38g1, d2c38g2, d2c38h1, d2c38h2, d2c38i1, d2c38i2, d2c38j1, d2c38j2, d2c38l1, d2c38l2, d2c38m1, d2c38m2, d2c38n1, d2c38n2, d2c38o1, d2c38o2, d2c38p1, d2c38p2, d2c38q1, d2c38q2, d2c38r1, d2c38r2, d2c38s1, d2c38s2, d2c38t1, d2c38t2, d2c38u1, d2c38u2, d2c38v1, d2c38v2, d2c38w1, d2c38w2, d2c38x1, d2c38x2