Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) |
Family d.101.1.0: automated matches [227218] (1 protein) not a true family |
Protein automated matches [226956] (5 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [232814] (4 PDB entries) |
Domain d2c38e2: 2c38 E:192-275 [146285] Other proteins in same PDB: d2c38a1, d2c38b1, d2c38b2, d2c38c1, d2c38d1, d2c38d2, d2c38e1, d2c38f1, d2c38f2, d2c38g1, d2c38h1, d2c38h2, d2c38i1, d2c38j1, d2c38j2, d2c38k1, d2c38l1, d2c38l2, d2c38m1, d2c38n1, d2c38n2, d2c38o1, d2c38p1, d2c38p2, d2c38q1, d2c38r1, d2c38r2, d2c38s1, d2c38t1, d2c38t2, d2c38u1, d2c38v1, d2c38v2, d2c38w1, d2c38x1, d2c38x2 automated match to d2je6a2 protein/RNA complex; complexed with amp, cl |
PDB Entry: 2c38 (more details), 3.1 Å
SCOPe Domain Sequences for d2c38e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c38e2 d.101.1.0 (E:192-275) automated matches {Sulfolobus solfataricus [TaxId: 2287]} plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi dqaentarstavklleelkkhlgi
Timeline for d2c38e2:
View in 3D Domains from other chains: (mouse over for more information) d2c38a1, d2c38a2, d2c38b1, d2c38b2, d2c38c1, d2c38c2, d2c38d1, d2c38d2, d2c38f1, d2c38f2, d2c38g1, d2c38g2, d2c38h1, d2c38h2, d2c38i1, d2c38i2, d2c38j1, d2c38j2, d2c38k1, d2c38k2, d2c38l1, d2c38l2, d2c38m1, d2c38m2, d2c38n1, d2c38n2, d2c38o1, d2c38o2, d2c38p1, d2c38p2, d2c38q1, d2c38q2, d2c38r1, d2c38r2, d2c38s1, d2c38s2, d2c38t1, d2c38t2, d2c38u1, d2c38u2, d2c38v1, d2c38v2, d2c38w1, d2c38w2, d2c38x1, d2c38x2 |