Lineage for d2c37i2 (2c37 I:192-275)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663434Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1663435Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 1663587Family d.101.1.0: automated matches [227218] (1 protein)
    not a true family
  6. 1663588Protein automated matches [226956] (5 species)
    not a true protein
  7. Species Sulfolobus solfataricus [TaxId:2287] [232814] (4 PDB entries)
  8. 1663634Domain d2c37i2: 2c37 I:192-275 [146245]
    Other proteins in same PDB: d2c37a1, d2c37b1, d2c37b2, d2c37c1, d2c37d1, d2c37d2, d2c37e1, d2c37f1, d2c37f2, d2c37g1, d2c37h1, d2c37h2, d2c37i1, d2c37j1, d2c37j2, d2c37k1, d2c37l1, d2c37l2, d2c37m1, d2c37n1, d2c37n2, d2c37o1, d2c37p1, d2c37p2, d2c37q1, d2c37r1, d2c37r2, d2c37s1, d2c37t1, d2c37t2, d2c37u1, d2c37v1, d2c37v2, d2c37w1, d2c37x1, d2c37x2
    automated match to d2je6a2
    protein/RNA complex; complexed with cl, na, rp5, u5p

Details for d2c37i2

PDB Entry: 2c37 (more details), 2.8 Å

PDB Description: rnase ph core of the archaeal exosome in complex with u8 rna
PDB Compounds: (I:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2c37i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c37i2 d.101.1.0 (I:192-275) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

SCOPe Domain Coordinates for d2c37i2:

Click to download the PDB-style file with coordinates for d2c37i2.
(The format of our PDB-style files is described here.)

Timeline for d2c37i2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c37i1
View in 3D
Domains from other chains:
(mouse over for more information)
d2c37a1, d2c37a2, d2c37b1, d2c37b2, d2c37c1, d2c37c2, d2c37d1, d2c37d2, d2c37e1, d2c37e2, d2c37f1, d2c37f2, d2c37g1, d2c37g2, d2c37h1, d2c37h2, d2c37j1, d2c37j2, d2c37k1, d2c37k2, d2c37l1, d2c37l2, d2c37m1, d2c37m2, d2c37n1, d2c37n2, d2c37o1, d2c37o2, d2c37p1, d2c37p2, d2c37q1, d2c37q2, d2c37r1, d2c37r2, d2c37s1, d2c37s2, d2c37t1, d2c37t2, d2c37u1, d2c37u2, d2c37v1, d2c37v2, d2c37w1, d2c37w2, d2c37x1, d2c37x2