SCOPe 2.06: Domain d2bxja1: 2bxj A:1-99

Lineage for d2bxja1 (2bxj A:1-99)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family)

5. Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)

6. Protein Ribosomal protein S6 [54997] (4 species)

7. Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
   Uniprot P23370

8. Domain d2bxja1: 2bxj A:1-99 [146222]
   mutant

Details for d2bxja1

PDB Entry: 2bxj, 2.4 Å

PDB Description: double mutant of the ribosomal protein s6

PDB Compounds: (A:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2bxja1:

Sequence; same for both SEQRES and ATOM records:

>d2bxja1 d.58.14.1 (A:1-99) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqraaenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndaarelrirdnvrrvmvvksqepfla

Timeline for d2bxja1:

• d2bxja1 first appeared in SCOP 1.75
  
• d2bxja1 appears in SCOPe 2.05
  
• d2bxja1 appears in SCOPe 2.07
  
• d2bxja1 appears in the current release, SCOPe 2.08