Lineage for d2bxja1 (2bxj A:1-99)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) 
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) Protein Ribosomal protein S6 [54997] (4 species) 
Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
Uniprot P23370
Domain d2bxja1: 2bxj A:1-99 [146222]
mutant
Details for d2bxja1
PDB Entry: 2bxj (more details), 2.4 Å
PDB Description: double mutant of the ribosomal protein s6
PDB Compounds: (A:) 30S ribosomal protein S6SCOP Domain Sequences for d2bxja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bxja1 d.58.14.1 (A:1-99) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqraaenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndaarelrirdnvrrvmvvksqepfla
SCOP Domain Coordinates for d2bxja1:
Click to download the PDB-style file with coordinates for d2bxja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bxja1:
- d2bxja1 is new in SCOP 1.75
- d2bxja1 appears in SCOPe 2.01
- d2bxja1 appears in the current release, SCOPe 2.08
View in 3D
