Lineage for d2btqa1 (2btq A:3-246)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863262Protein Tubulin alpha-subunit [52494] (3 species)
  7. 2863275Species Prosthecobacter dejongeii [TaxId:48465] [159531] (2 PDB entries)
    Uniprot Q8GCC5 3-246
    bacterial tubulin BtubA
  8. 2863278Domain d2btqa1: 2btq A:3-246 [146216]
    Other proteins in same PDB: d2btqa2
    automatically matched to 2BTO A:3-246
    complexed with gdp, so4

Details for d2btqa1

PDB Entry: 2btq (more details), 3.2 Å

PDB Description: structure of btubab heterodimer from prosthecobacter dejongeii
PDB Compounds: (A:) tubulin btuba

SCOPe Domain Sequences for d2btqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btqa1 c.32.1.1 (A:3-246) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]}
vnntivvsigqagnqiaasfwktvclehgidpltgqtapgvaprgnwssffsklgesssg
syvpraimvdlepsvidnvkatsgslfnpanlisrtegaggnfavgylgagrevlpevms
rldyeidkcdnvggiivlhaigggtgsgfgallieslkekygeipvlscavlpspqvssv
vtepyntvfalntlrrsadaclifdnealfdlahrkwniesptvddlnllitealagita
smrf

SCOPe Domain Coordinates for d2btqa1:

Click to download the PDB-style file with coordinates for d2btqa1.
(The format of our PDB-style files is described here.)

Timeline for d2btqa1: