Lineage for d2br2v2 (2br2 V:156-248)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920395Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1920396Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 1920397Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 1920398Protein Exosome complex exonuclease 1, ECX1 [160590] (2 species)
  7. 1920406Species Sulfolobus solfataricus [TaxId:2287] [160591] (9 PDB entries)
    Uniprot Q9UXC2 156-241! Uniprot Q9UXC2 156-248
  8. 1920421Domain d2br2v2: 2br2 V:156-248 [146208]
    Other proteins in same PDB: d2br2a1, d2br2a2, d2br2b1, d2br2c1, d2br2c2, d2br2d1, d2br2e1, d2br2e2, d2br2f1, d2br2g1, d2br2g2, d2br2h1, d2br2i1, d2br2i2, d2br2j1, d2br2k1, d2br2k2, d2br2l1, d2br2m1, d2br2m2, d2br2n1, d2br2o1, d2br2o2, d2br2p1, d2br2q1, d2br2q2, d2br2r1, d2br2s1, d2br2s2, d2br2t1, d2br2u1, d2br2u2, d2br2v1, d2br2w1, d2br2w2, d2br2x1
    automated match to d2br2b2
    complexed with cl

Details for d2br2v2

PDB Entry: 2br2 (more details), 2.8 Å

PDB Description: rnase ph core of the archaeal exosome
PDB Compounds: (V:) exosome complex exonuclease 1

SCOPe Domain Sequences for d2br2v2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2br2v2 d.101.1.1 (V:156-248) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
pmrdliagvavgkadgviildlnetedmwgeadmpiammpslnqvtlfqlngsmtpdefr
qafdlavkginiiynlerealkskyvefkeegv

SCOPe Domain Coordinates for d2br2v2:

Click to download the PDB-style file with coordinates for d2br2v2.
(The format of our PDB-style files is described here.)

Timeline for d2br2v2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2br2v1
View in 3D
Domains from other chains:
(mouse over for more information)
d2br2a1, d2br2a2, d2br2b1, d2br2b2, d2br2c1, d2br2c2, d2br2d1, d2br2d2, d2br2e1, d2br2e2, d2br2f1, d2br2f2, d2br2g1, d2br2g2, d2br2h1, d2br2h2, d2br2i1, d2br2i2, d2br2j1, d2br2j2, d2br2k1, d2br2k2, d2br2l1, d2br2l2, d2br2m1, d2br2m2, d2br2n1, d2br2n2, d2br2o1, d2br2o2, d2br2p1, d2br2p2, d2br2q1, d2br2q2, d2br2r1, d2br2r2, d2br2s1, d2br2s2, d2br2t1, d2br2t2, d2br2u1, d2br2u2, d2br2w1, d2br2w2, d2br2x1, d2br2x2