Lineage for d2ba1h1 (2ba1 H:3-178)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016991Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1016992Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1017230Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)
  6. 1017290Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species)
  7. 1017291Species Archaeoglobus fulgidus [TaxId:2234] [159921] (2 PDB entries)
    Uniprot O29756 3-178
  8. 1017296Domain d2ba1h1: 2ba1 H:3-178 [146125]
    Other proteins in same PDB: d2ba1d1, d2ba1d2, d2ba1e1, d2ba1e2, d2ba1f1, d2ba1f2, d2ba1g2, d2ba1h2, d2ba1i2
    automatically matched to 2BA0 G:3-178
    complexed with zn

Details for d2ba1h1

PDB Entry: 2ba1 (more details), 2.7 Å

PDB Description: archaeal exosome core
PDB Compounds: (H:) Archaeal exosome complex exonuclease RRP42

SCOPe Domain Sequences for d2ba1h1:

Sequence, based on SEQRES records: (download)

>d2ba1h1 d.14.1.4 (H:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]}
edilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvgv
kmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavdls
klvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyll

Sequence, based on observed residues (ATOM records): (download)

>d2ba1h1 d.14.1.4 (H:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]}
edilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvgv
kmqpgepypdtpdrgviivnaelvpdensielarvvdrgireseavdlsklvieegekvw
ivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyll

SCOPe Domain Coordinates for d2ba1h1:

Click to download the PDB-style file with coordinates for d2ba1h1.
(The format of our PDB-style files is described here.)

Timeline for d2ba1h1: