Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins) |
Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [159921] (2 PDB entries) Uniprot O29756 3-178 |
Domain d2ba1h1: 2ba1 H:3-178 [146125] Other proteins in same PDB: d2ba1d1, d2ba1d2, d2ba1e1, d2ba1e2, d2ba1f1, d2ba1f2, d2ba1g2, d2ba1h2, d2ba1i2 automatically matched to 2BA0 G:3-178 complexed with zn |
PDB Entry: 2ba1 (more details), 2.7 Å
SCOPe Domain Sequences for d2ba1h1:
Sequence, based on SEQRES records: (download)
>d2ba1h1 d.14.1.4 (H:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]} edilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvgv kmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavdls klvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyll
>d2ba1h1 d.14.1.4 (H:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]} edilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvgv kmqpgepypdtpdrgviivnaelvpdensielarvvdrgireseavdlsklvieegekvw ivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyll
Timeline for d2ba1h1: