SCOP 1.75: Domain d2ba1h1: 2ba1 H:3-178

Lineage for d2ba1h1 (2ba1 H:3-178)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)

6. Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [159921] (2 PDB entries)
   Uniprot O29756 3-178

8. Domain d2ba1h1: 2ba1 H:3-178 [146125]
   Other proteins in same PDB: d2ba1d1, d2ba1d2, d2ba1e1, d2ba1e2, d2ba1f1, d2ba1f2, d2ba1g2, d2ba1h2, d2ba1i2
   automatically matched to 2BA0 G:3-178
   complexed with zn

Details for d2ba1h1

PDB Entry: 2ba1, 2.7 Å

PDB Description: archaeal exosome core

PDB Compounds: (H:) Archaeal exosome complex exonuclease RRP42

SCOP Domain Sequences for d2ba1h1:

Sequence, based on SEQRES records:

>d2ba1h1 d.14.1.4 (H:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]}
edilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvgv
kmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavdls
klvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyll

Sequence, based on observed residues (ATOM records):

>d2ba1h1 d.14.1.4 (H:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]}
edilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvgv
kmqpgepypdtpdrgviivnaelvpdensielarvvdrgireseavdlsklvieegekvw
ivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyll

Timeline for d2ba1h1:

• d2ba1h1 is new in SCOP 1.75
  
• d2ba1h1 appears in SCOPe 2.01
  
• d2ba1h1 appears in the current release, SCOPe 2.08