Lineage for d2ba1g2 (2ba1 G:179-258)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920395Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1920396Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 1920397Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 1920459Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species)
  7. 1920460Species Archaeoglobus fulgidus [TaxId:2234] [160598] (4 PDB entries)
    Uniprot O29756 179-257
  8. 1920467Domain d2ba1g2: 2ba1 G:179-258 [146124]
    Other proteins in same PDB: d2ba1d1, d2ba1d2, d2ba1e1, d2ba1e2, d2ba1f1, d2ba1f2, d2ba1g1, d2ba1h1, d2ba1i1
    automated match to d2ba0g2
    complexed with zn

Details for d2ba1g2

PDB Entry: 2ba1 (more details), 2.7 Å

PDB Description: archaeal exosome core
PDB Compounds: (G:) Archaeal exosome complex exonuclease RRP42

SCOPe Domain Sequences for d2ba1g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ba1g2 d.101.1.1 (G:179-258) Exosome complex exonuclease 2, ECX2 {Archaeoglobus fulgidus [TaxId: 2234]}
pvrdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklf
delldvsincarklrekfke

SCOPe Domain Coordinates for d2ba1g2:

Click to download the PDB-style file with coordinates for d2ba1g2.
(The format of our PDB-style files is described here.)

Timeline for d2ba1g2: