Lineage for d2ba1e1 (2ba1 E:9-153)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891698Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1891699Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1891941Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 1891942Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)
  7. 1891943Species Archaeoglobus fulgidus [TaxId:2234] [159925] (2 PDB entries)
    Uniprot O29757 10-153
  8. 1891948Domain d2ba1e1: 2ba1 E:9-153 [146119]
    Other proteins in same PDB: d2ba1d2, d2ba1e2, d2ba1f2, d2ba1g1, d2ba1g2, d2ba1h1, d2ba1h2, d2ba1i1, d2ba1i2
    automated match to d2ba0d1
    complexed with zn

Details for d2ba1e1

PDB Entry: 2ba1 (more details), 2.7 Å

PDB Description: archaeal exosome core
PDB Compounds: (E:) Archaeal exosome complex exonuclease RRP41

SCOPe Domain Sequences for d2ba1e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ba1e1 d.14.1.4 (E:9-153) Exosome complex exonuclease 1, ECX1 {Archaeoglobus fulgidus [TaxId: 2234]}
eklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgprevhprhlq
dpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfprsaidifve
vlqadagsrtaclnaasvalvdagv

SCOPe Domain Coordinates for d2ba1e1:

Click to download the PDB-style file with coordinates for d2ba1e1.
(The format of our PDB-style files is described here.)

Timeline for d2ba1e1: