Lineage for d2b0ga1 (2b0g A:1-83)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195357Protein Splicesomal U1A protein [54932] (2 species)
    duplication: contains two domains of this fold
  7. 2195358Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [160313] (3 PDB entries)
    Uniprot P43332 1-104! Uniprot P43332 134-216
  8. 2195359Domain d2b0ga1: 2b0g A:1-83 [146085]
    2nd RBD

Details for d2b0ga1

PDB Entry: 2b0g (more details)

PDB Description: solution structure of drosophila melanogaster snf rbd2
PDB Compounds: (A:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d2b0ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aqteqppnqilfltnlpeetnemmlsmlfnqfpgfkevrlvpnrhdiafvefttelqsna
akealqgfkitpthamkitfakk

SCOPe Domain Coordinates for d2b0ga1:

Click to download the PDB-style file with coordinates for d2b0ga1.
(The format of our PDB-style files is described here.)

Timeline for d2b0ga1: