Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Splicesomal U1A protein [54932] (2 species) duplication: contains two domains of this fold |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [160313] (3 PDB entries) Uniprot P43332 1-104! Uniprot P43332 134-216 |
Domain d2b0ga1: 2b0g A:1-83 [146085] 2nd RBD |
PDB Entry: 2b0g (more details)
SCOPe Domain Sequences for d2b0ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} aqteqppnqilfltnlpeetnemmlsmlfnqfpgfkevrlvpnrhdiafvefttelqsna akealqgfkitpthamkitfakk
Timeline for d2b0ga1: