Lineage for d2ay0c_ (2ay0 C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915404Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 915405Superfamily a.43.1: Ribbon-helix-helix [47598] (11 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 915586Family a.43.1.11: PutA pre-N-terminal region-like [158485] (2 proteins)
    in PutA it forms a separate ribbon-helix-helix domain connected to the N-terminal enzymatic domain by a flexible linker
  6. 915587Protein Bifunctional protein putA [158486] (1 species)
  7. 915588Species Escherichia coli [TaxId:562] [158487] (2 PDB entries)
    Uniprot P09546 3-45
  8. 915591Domain d2ay0c_: 2ay0 C: [146079]
    automated match to d2ay0a1
    complexed with cl; mutant

Details for d2ay0c_

PDB Entry: 2ay0 (more details), 2.1 Å

PDB Description: structure of the lys9met mutant of the e. coli proline utilization a (puta) dna-binding domain.
PDB Compounds: (C:) Bifunctional putA protein

SCOPe Domain Sequences for d2ay0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ay0c_ a.43.1.11 (C:) Bifunctional protein putA {Escherichia coli [TaxId: 562]}
gtttmgvmlddatreriksaatridrtphwlikqaifsyleqle

SCOPe Domain Coordinates for d2ay0c_:

Click to download the PDB-style file with coordinates for d2ay0c_.
(The format of our PDB-style files is described here.)

Timeline for d2ay0c_: