Lineage for d2asxa1 (2asx A:278-331)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781212Fold a.274: HAMP domain-like [158471] (1 superfamily)
    dimer of helix-loop-helix segments; distict from the HLH-like fold; parallel four-helical bundle with two overside connections
  4. 781213Superfamily a.274.1: HAMP domain-like [158472] (1 family) (S)
  5. 781214Family a.274.1.1: HAMP domain [158473] (1 protein)
    Pfam PF00672
  6. 781215Protein Hypothetical protein AF1503 [158474] (1 species)
    C-terminal domain
  7. 781216Species Archaeoglobus fulgidus [TaxId:2234] [158475] (2 PDB entries)
    Uniprot O28769 278-331
  8. 781217Domain d2asxa1: 2asx A:278-331 [146067]
    automatically matched to 2ASW A:278-331

Details for d2asxa1

PDB Entry: 2asx (more details)

PDB Description: The solution structure of the hamp domain of the hypothetical transmembrane receptor Af1503
PDB Compounds: (A:) hypothetical protein AF1503

SCOP Domain Sequences for d2asxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2asxa1 a.274.1.1 (A:278-331) Hypothetical protein AF1503 {Archaeoglobus fulgidus [TaxId: 2234]}
stitrpiielsntadkiaegnleaevphqnradeigilaksierlrrslkvame

SCOP Domain Coordinates for d2asxa1:

Click to download the PDB-style file with coordinates for d2asxa1.
(The format of our PDB-style files is described here.)

Timeline for d2asxa1:

  • d2asxa1 is new in SCOP 1.75
  • d2asxa1 became obsolete in SCOPe 2.01