SCOP 1.75: Domain d2aswb1: 2asw B:278-331

Lineage for d2aswb1 (2asw B:278-331)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.274: HAMP domain-like [158471] (1 superfamily)
   dimer of helix-loop-helix segments; distict from the HLH-like fold; parallel four-helical bundle with two overside connections

4. Superfamily a.274.1: HAMP domain-like [158472] (1 family)

5. Family a.274.1.1: HAMP domain [158473] (1 protein)
   Pfam PF00672

6. Protein Hypothetical protein AF1503 [158474] (1 species)
   C-terminal domain

7. Species Archaeoglobus fulgidus [TaxId:2234] [158475] (2 PDB entries)
   Uniprot O28769 278-331

8. Domain d2aswb1: 2asw B:278-331 [146066]
   automatically matched to 2ASW A:278-331

Details for d2aswb1

PDB Entry: 2asw

PDB Description: The solution structure of the hamp domain of the hypothetical transmembrane receptor Af1503

PDB Compounds: (B:) hypothetical protein AF1503

SCOP Domain Sequences for d2aswb1:

Sequence; same for both SEQRES and ATOM records:

>d2aswb1 a.274.1.1 (B:278-331) Hypothetical protein AF1503 {Archaeoglobus fulgidus [TaxId: 2234]}
stitrpiielsntadkiaegnleaevphqnradeigilaksierlrrslkvame

Timeline for d2aswb1:

• d2aswb1 is new in SCOP 1.75
  
• d2aswb1 does not appear in SCOPe 2.01