Lineage for d2alea1 (2ale A:1-126)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1032069Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1032367Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 1032368Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 1032464Protein Small nuclear ribonucleoprotein-associated protein 1, Snu13p [160504] (1 species)
  7. 1032465Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [160505] (2 PDB entries)
    Uniprot P39990 1-126! Uniprot P39990 2-126
  8. 1032468Domain d2alea1: 2ale A:1-126 [146061]
    complexed with mg

Details for d2alea1

PDB Entry: 2ale (more details), 1.8 Å

PDB Description: Crystal structure of yeast RNA splicing factor Snu13p
PDB Compounds: (A:) NHP2/L7aE family protein YEL026W

SCOPe Domain Sequences for d2alea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msapnpkafpladaaltqqildvvqqaanlrqlkkganeatktlnrgisefiimaadcep
ieillhlpllcedknvpyvfvpsrvalgracgvsrpviaasittndasaiktqiyavkdk
ietlli

SCOPe Domain Coordinates for d2alea1:

Click to download the PDB-style file with coordinates for d2alea1.
(The format of our PDB-style files is described here.)

Timeline for d2alea1: