Lineage for d2aarw1 (2aar W:2-66)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
2 helices; antiparallel hairpin, left-handed twist
Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) 
Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) Protein Ribosomal protein L29 (L29p) [46563] (5 species) 
Species Deinococcus radiodurans [TaxId:1299] [158220] (8 PDB entries)
Uniprot Q9RXJ4 1-66
Domain d2aarw1: 2aar W:2-66 [146044]
Other proteins in same PDB: d2aarr1
automatically matched to 2ZJR V:1-66
Details for d2aarw1
PDB Entry: 2aar (more details), 3.5 Å
PDB Description: structure of trigger factor binding domain in biologically homologous complex with eubacterial ribosome.
PDB Compounds: (W:) 50S ribosomal protein L29SCOP Domain Sequences for d2aarw1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aarw1 a.2.2.1 (W:2-66) Ribosomal protein L29 (L29p) {Deinococcus radiodurans [TaxId: 1299]}
kpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkaela
rkgeq
SCOP Domain Coordinates for d2aarw1:
Click to download the PDB-style file with coordinates for d2aarw1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aarw1:
- d2aarw1 is new in SCOP 1.75
- d2aarw1 appears in SCOPe 2.01
- d2aarw1 appears in the current release, SCOPe 2.08
View in 3D
