Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) |
Family d.12.1.1: L23p [54190] (1 protein) |
Protein Ribosomal protein L23 [54191] (4 species) |
Species Deinococcus radiodurans [TaxId:1299] [159877] (8 PDB entries) Uniprot Q9RXK0 2-94 |
Domain d2aarr1: 2aar R:2-94 [146043] Other proteins in same PDB: d2aarw1 automatically matched to 2ZJR Q:2-94 |
PDB Entry: 2aar (more details), 3.5 Å
SCOPe Domain Sequences for d2aarr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aarr1 d.12.1.1 (R:2-94) Ribosomal protein L23 {Deinococcus radiodurans [TaxId: 1299]} shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk rkrvgrfigqrndrkkaivrlaegqsiealagq
Timeline for d2aarr1: