Lineage for d2a1ka_ (2a1k A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 950107Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 950948Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins)
    barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms
  6. 950985Protein automated matches [190382] (1 species)
    not a true protein
  7. 950986Species Enterobacteria phage [TaxId:12353] [187231] (1 PDB entry)
  8. 950987Domain d2a1ka_: 2a1k A: [146038]
    automated match to d1gpca_
    complexed with zn

Details for d2a1ka_

PDB Entry: 2a1k (more details), 2 Å

PDB Description: RB69 single-stranded DNA binding protein core domain
PDB Compounds: (A:) gp32 single stranded DNA binding protein

SCOPe Domain Sequences for d2a1ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1ka_ b.40.4.7 (A:) automated matches {Enterobacteria phage [TaxId: 12353]}
dkgewklkldasgngqavirflpaktddalpfailvnhgfkkngkwyietcssthgdyds
cpvcqyiskndlyntnkteysqlkrktsywanilvvkdpqapdnegkvfkyrfgkkiwdk
inamiavdtemgetpvdvtcpweganfvlkvkqvsgfsnydeskflnqsaipniddesfq
kelfeqmvdlsemtskdkfksfeelntkfnqvlgt

SCOPe Domain Coordinates for d2a1ka_:

Click to download the PDB-style file with coordinates for d2a1ka_.
(The format of our PDB-style files is described here.)

Timeline for d2a1ka_: