Lineage for d2a1ka1 (2a1k A:32-241)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 800209Family b.40.4.7: Phage ssDNA-binding proteins [50315] (3 proteins)
    barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms
  6. 800210Protein Gene 32 protein (gp32) core [50319] (2 species)
    contains a Zn-finger subdomain, res. 63-111
  7. 800213Species Enterobacteria phage RB69 [TaxId:12353] [159108] (2 PDB entries)
    Uniprot Q7Y265 32-241
  8. 800214Domain d2a1ka1: 2a1k A:32-241 [146038]
    automatically matched to 2ATQ B:32-241
    complexed with zn

Details for d2a1ka1

PDB Entry: 2a1k (more details), 2 Å

PDB Description: RB69 single-stranded DNA binding protein core domain
PDB Compounds: (A:) gp32 single stranded DNA binding protein

SCOP Domain Sequences for d2a1ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1ka1 b.40.4.7 (A:32-241) Gene 32 protein (gp32) core {Enterobacteria phage RB69 [TaxId: 12353]}
klkldasgngqavirflpaktddalpfailvnhgfkkngkwyietcssthgdydscpvcq
yiskndlyntnkteysqlkrktsywanilvvkdpqapdnegkvfkyrfgkkiwdkinami
avdtemgetpvdvtcpweganfvlkvkqvsgfsnydeskflnqsaipniddesfqkelfe
qmvdlsemtskdkfksfeelntkfnqvlgt

SCOP Domain Coordinates for d2a1ka1:

Click to download the PDB-style file with coordinates for d2a1ka1.
(The format of our PDB-style files is described here.)

Timeline for d2a1ka1: