Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.62: Ribosomal protein L10-like [160369] (1 family) consists of globular N-terminal domain, structurally similar to NDK, and the L7/L12-binding C-terminal alpha-helical tail |
Family d.58.62.1: Ribosomal protein L10-like [160370] (1 protein) Pfam PF00466; covers globular domain only |
Protein Ribosomal protein L10 [160371] (1 species) see also (64661) for a partial structure in the ribosome |
Species Thermotoga maritima [TaxId:2336] [160372] (3 PDB entries) Uniprot P29394 1-177 |
Domain d1zawa1: 1zaw A:1-177 [145969] Other proteins in same PDB: d1zawu1, d1zawv1, d1zaww1, d1zawx1, d1zawy1, d1zawz1 automatically matched to 1ZAV A:1-177 protein/RNA complex |
PDB Entry: 1zaw (more details), 2.3 Å
SCOPe Domain Sequences for d1zawa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zawa1 d.58.62.1 (A:1-177) Ribosomal protein L10 {Thermotoga maritima [TaxId: 2336]} mltrqqkelivkemseifkktslilfadflgftvadltelrsrlrekygdgarfrvvknt llnlalknaeyegyeeflkgptavlyvtegdpveavkiiynfykdkkadlsrlkggfleg kkftaeeveniaklpskeelyamlvgrvkapitglvfalsgilrnlvyvlnaikekk
Timeline for d1zawa1: