Lineage for d1zava1 (1zav A:1-177)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1207919Superfamily d.58.62: Ribosomal protein L10-like [160369] (1 family) (S)
    consists of globular N-terminal domain, structurally similar to NDK, and the L7/L12-binding C-terminal alpha-helical tail
  5. 1207920Family d.58.62.1: Ribosomal protein L10-like [160370] (1 protein)
    Pfam PF00466; covers globular domain only
  6. 1207921Protein Ribosomal protein L10 [160371] (1 species)
    see also (64661) for a partial structure in the ribosome
  7. 1207922Species Thermotoga maritima [TaxId:2336] [160372] (3 PDB entries)
    Uniprot P29394 1-177
  8. 1207923Domain d1zava1: 1zav A:1-177 [145962]
    Other proteins in same PDB: d1zavu1, d1zavv1, d1zavw1, d1zavx1, d1zavy1, d1zavz1
    protein/RNA complex

Details for d1zava1

PDB Entry: 1zav (more details), 1.9 Å

PDB Description: Ribosomal Protein L10-L12(NTD) Complex, Space Group P21
PDB Compounds: (A:) 50s ribosomal protein l10

SCOPe Domain Sequences for d1zava1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zava1 d.58.62.1 (A:1-177) Ribosomal protein L10 {Thermotoga maritima [TaxId: 2336]}
mltrqqkelivkemseifkktslilfadflgftvadltelrsrlrekygdgarfrvvknt
llnlalknaeyegyeeflkgptavlyvtegdpveavkiiynfykdkkadlsrlkggfleg
kkftaeeveniaklpskeelyamlvgrvkapitglvfalsgilrnlvyvlnaikekk

SCOPe Domain Coordinates for d1zava1:

Click to download the PDB-style file with coordinates for d1zava1.
(The format of our PDB-style files is described here.)

Timeline for d1zava1: