SCOPe 2.01: Domain d1z96b_: 1z96 B:

Lineage for d1z96b_ (1z96 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (4 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein UBA-domain protein mud1 [158356] (1 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [158357] (1 PDB entry)
   Uniprot Q10256 295-332

8. Domain d1z96b_: 1z96 B: [145961]
   automated match to d1z96a1

Details for d1z96b_

PDB Entry: 1z96, 1.8 Å

PDB Description: Crystal structure of the Mud1 UBA domain

PDB Compounds: (B:) UBA-domain protein mud1

SCOPe Domain Sequences for d1z96b_:

Sequence; same for both SEQRES and ATOM records:

>d1z96b_ a.5.2.1 (B:) UBA-domain protein mud1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
skiaqlvsmgfdpleaaqaldaangdldvaasfll

Timeline for d1z96b_:

• d1z96b_ first appeared in SCOP 1.75, called d1z96b1
  
• d1z96b_ appears in SCOPe 2.02
  
• d1z96b_ appears in the current release, SCOPe 2.08