![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins) lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G) |
![]() | Protein automated matches [190844] (1 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [188163] (3 PDB entries) |
![]() | Domain d1z0nb_: 1z0n B: [145956] Other proteins in same PDB: d1z0na1 automated match to d1z0na1 complexed with bcd |
PDB Entry: 1z0n (more details), 1.49 Å
SCOPe Domain Sequences for d1z0nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z0nb_ b.1.18.21 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} arptvfrwtgggkevylsgsfnnwsklpmtrsqnnfvaildlpegehqykffvdgqwthd psepivtsqlgtvnniiqvk
Timeline for d1z0nb_: