Lineage for d1z0mb_ (1z0m B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039459Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
    lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)
  6. 2039494Protein automated matches [190844] (1 species)
    not a true protein
  7. 2039495Species Norway rat (Rattus norvegicus) [TaxId:10116] [188163] (3 PDB entries)
  8. 2039498Domain d1z0mb_: 1z0m B: [145953]
    Other proteins in same PDB: d1z0ma1
    automated match to d1z0ma1
    complexed with bcd

Details for d1z0mb_

PDB Entry: 1z0m (more details), 1.91 Å

PDB Description: the glycogen-binding domain of the amp-activated protein kinase beta1 subunit
PDB Compounds: (B:) 5'-AMP-activated protein kinase, beta-1 subunit

SCOPe Domain Sequences for d1z0mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0mb_ b.1.18.21 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qarptvfrwtgggkevylsgsfnnwsklpltrsqnnfvaildlpegehqykffvdgqwth
dpsepivtsqlgtvnniiqvk

SCOPe Domain Coordinates for d1z0mb_:

Click to download the PDB-style file with coordinates for d1z0mb_.
(The format of our PDB-style files is described here.)

Timeline for d1z0mb_: