SCOPe 2.04: Domain d1y6ea2: 1y6e A:1-79

Lineage for d1y6ea2 (1y6e A:1-79)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (133 species)
   not a true protein

7. Species Schistosoma japonicum [TaxId:6182] [225614] (3 PDB entries)

8. Domain d1y6ea2: 1y6e A:1-79 [145909]
   Other proteins in same PDB: d1y6ea1, d1y6eb1
   automated match to d1gnea2

Details for d1y6ea2

PDB Entry: 1y6e, 3 Å

PDB Description: Orthorhombic glutathione S-transferase of Schistosoma japonicum

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1y6ea2:

Sequence; same for both SEQRES and ATOM records:

>d1y6ea2 c.47.1.0 (A:1-79) automated matches {Schistosoma japonicum [TaxId: 6182]}
spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
dvkltqsmaiiryiadkhn

Timeline for d1y6ea2:

• d1y6ea2 first appeared in SCOP 1.75
  
• d1y6ea2 appears in SCOPe 2.03
  
• d1y6ea2 appears in SCOPe 2.05
  
• d1y6ea2 appears in the current release, SCOPe 2.08