Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein c-src protein tyrosine kinase [50064] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [50065] (6 PDB entries) |
Domain d1y57a1: 1y57 A:82-145 [145903] Other proteins in same PDB: d1y57a2, d1y57a3 automated match to d1fmka1 complexed with mpz, so4 |
PDB Entry: 1y57 (more details), 1.91 Å
SCOPe Domain Sequences for d1y57a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y57a1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} mvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd siqa
Timeline for d1y57a1: