Lineage for d1y57a1 (1y57 A:85-140)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796151Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 796152Family b.34.2.1: SH3-domain [50045] (39 proteins)
  6. 796230Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 796244Species Human (Homo sapiens) [TaxId:9606] [50065] (5 PDB entries)
  8. 796246Domain d1y57a1: 1y57 A:85-140 [145903]
    Other proteins in same PDB: d1y57a2, d1y57a3
    automatically matched to d1nloc_
    complexed with mpz, so4

Details for d1y57a1

PDB Entry: 1y57 (more details), 1.91 Å

PDB Description: structure of unphosphorylated c-src in complex with an inhibitor
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOP Domain Sequences for d1y57a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y57a1 b.34.2.1 (A:85-140) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvaps

SCOP Domain Coordinates for d1y57a1:

Click to download the PDB-style file with coordinates for d1y57a1.
(The format of our PDB-style files is described here.)

Timeline for d1y57a1: