Lineage for d1y57a1 (1y57 A:83-145)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782953Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 2782975Species Human (Homo sapiens) [TaxId:9606] [50065] (7 PDB entries)
  8. 2782980Domain d1y57a1: 1y57 A:83-145 [145903]
    Other proteins in same PDB: d1y57a2, d1y57a3, d1y57a4
    automated match to d1fmka1
    complexed with mpz, so4

Details for d1y57a1

PDB Entry: 1y57 (more details), 1.91 Å

PDB Description: structure of unphosphorylated c-src in complex with an inhibitor
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d1y57a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y57a1 b.34.2.1 (A:83-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
vttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsds
iqa

SCOPe Domain Coordinates for d1y57a1:

Click to download the PDB-style file with coordinates for d1y57a1.
(The format of our PDB-style files is described here.)

Timeline for d1y57a1: