Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices |
Family d.110.7.1: Roadblock/LC7 domain [103197] (4 proteins) Pfam PF03259 |
Protein Dynein light chain 2A, cytoplasmic [118074] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [160682] (1 PDB entry) Uniprot P62627 1-95 |
Domain d1y4oa1: 1y4o A:10-104 [145901] |
PDB Entry: 1y4o (more details)
SCOP Domain Sequences for d1y4oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y4oa1 d.110.7.1 (A:10-104) Dynein light chain 2A, cytoplasmic {Mouse (Mus musculus) [TaxId: 10090]} aeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyanlmhnfilkarstvreid pqndltflrirskkneimvapdkdyfliviqnpte
Timeline for d1y4oa1: