SCOPe 2.05: Domain d1xbpu1: 1xbp U:2-85

Lineage for d1xbpu1 (1xbp U:2-85)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families)
   rudiment single hybrid fold with a permuted topology

5. Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
   Pfam PF01016

6. Protein Ribosomal protein L27 [110326] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159323] (7 PDB entries)
   Uniprot Q9RY65 2-85

8. Domain d1xbpu1: 1xbp U:2-85 [145886]
   Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpw1, d1xbpx1, d1xbpz1
   automatically matched to 2ZJR T:2-85
   complexed with mul

Details for d1xbpu1

PDB Entry: 1xbp, 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin

PDB Compounds: (U:) 50S ribosomal protein L27

SCOPe Domain Sequences for d1xbpu1:

Sequence; same for both SEQRES and ATOM records:

>d1xbpu1 b.84.4.1 (U:2-85) Ribosomal protein L27 {Deinococcus radiodurans [TaxId: 1299]}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaq

Timeline for d1xbpu1:

• d1xbpu1 first appeared in SCOP 1.75
  
• d1xbpu1 appears in SCOPe 2.04
  
• d1xbpu1 appears in SCOPe 2.06
  
• d1xbpu1 appears in the current release, SCOPe 2.08