Lineage for d1xbpl1 (1xbp L:3-115)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684938Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 1684939Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
    automatically mapped to Pfam PF01196
  5. 1684940Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 1684941Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 1684942Species Deinococcus radiodurans [TaxId:1299] [160268] (6 PDB entries)
    Uniprot Q9RSJ5 3-115
  8. 1684948Domain d1xbpl1: 1xbp L:3-115 [145877]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR K:3-115
    complexed with mul

Details for d1xbpl1

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (L:) 50S ribosomal protein L17

SCOPe Domain Sequences for d1xbpl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbpl1 d.188.1.1 (L:3-115) Prokaryotic ribosomal protein L17 {Deinococcus radiodurans [TaxId: 1299]}
hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmaliel

SCOPe Domain Coordinates for d1xbpl1:

Click to download the PDB-style file with coordinates for d1xbpl1.
(The format of our PDB-style files is described here.)

Timeline for d1xbpl1: