Lineage for d1xbp31 (1xbp 3:2-64)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1688711Fold d.301: L35p-like [143033] (1 superfamily)
    core: alpha-beta(3)-alpha; 2layers a/b
  4. 1688712Superfamily d.301.1: L35p-like [143034] (1 family) (S)
    automatically mapped to Pfam PF01632
  5. 1688713Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
    Pfam PF01632
  6. 1688714Protein Ribosomal protein L35p [143036] (3 species)
  7. Species Deinococcus radiodurans [TaxId:1299] [160056] (6 PDB entries)
    Uniprot Q9RSW6 2-64
  8. 1688721Domain d1xbp31: 1xbp 3:2-64 [145863]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR 3:2-64
    complexed with mul

Details for d1xbp31

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (3:) 50S ribosomal protein L35

SCOPe Domain Sequences for d1xbp31:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbp31 d.301.1.1 (3:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

SCOPe Domain Coordinates for d1xbp31:

Click to download the PDB-style file with coordinates for d1xbp31.
(The format of our PDB-style files is described here.)

Timeline for d1xbp31: