Class j: Peptides [58231] (120 folds) |
Fold j.118: Ribosomal protein L34p [144320] (1 superfamily) non-globular, mainly alpha-helical |
Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) |
Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein) Pfam PF00468 |
Protein Ribosomal protein L34p [144323] (3 species) |
Species Deinococcus radiodurans [TaxId:1299] [161305] (6 PDB entries) Uniprot Q9RSH2 1-46 |
Domain d1xbp21: 1xbp 2:1-46 [145862] Other proteins in same PDB: d1xbp11, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1 automatically matched to 2ZJR 2:1-46 complexed with mul |
PDB Entry: 1xbp (more details), 3.5 Å
SCOPe Domain Sequences for d1xbp21:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbp21 j.118.1.1 (2:1-46) Ribosomal protein L34p {Deinococcus radiodurans [TaxId: 1299]} mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd
Timeline for d1xbp21:
View in 3D Domains from other chains: (mouse over for more information) d1xbp11, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1 |