Lineage for d1wspc_ (1wsp C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540190Family d.15.1.8: DIX domain [159926] (2 proteins)
    Pfam PF00778
  6. 2540191Protein Axin 1 [159927] (1 species)
  7. 2540192Species Norway rat (Rattus norvegicus) [TaxId:10116] [159928] (2 PDB entries)
    Uniprot O70239 745-827
  8. 2540195Domain d1wspc_: 1wsp C: [145836]
    automated match to d1wspa1
    complexed with bez, hg

Details for d1wspc_

PDB Entry: 1wsp (more details), 2.9 Å

PDB Description: Crystal structure of axin dix domain
PDB Compounds: (C:) Axin 1 protein

SCOPe Domain Sequences for d1wspc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wspc_ d.15.1.8 (C:) Axin 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pcdsivvayyfcgepipyrtlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfe
evredeailpvfeekiigkvekvd

SCOPe Domain Coordinates for d1wspc_:

Click to download the PDB-style file with coordinates for d1wspc_.
(The format of our PDB-style files is described here.)

Timeline for d1wspc_: