SCOPe 2.01: Domain d1wspc_: 1wsp C:

Lineage for d1wspc_ (1wsp C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.8: DIX domain [159926] (1 protein)
   Pfam PF00778

6. Protein Axin 1 [159927] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [159928] (2 PDB entries)
   Uniprot O70239 745-827

8. Domain d1wspc_: 1wsp C: [145836]
   automated match to d1wspa1
   complexed with bez, hg

Details for d1wspc_

PDB Entry: 1wsp, 2.9 Å

PDB Description: Crystal structure of axin dix domain

PDB Compounds: (C:) Axin 1 protein

SCOPe Domain Sequences for d1wspc_:

Sequence; same for both SEQRES and ATOM records:

>d1wspc_ d.15.1.8 (C:) Axin 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pcdsivvayyfcgepipyrtlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfe
evredeailpvfeekiigkvekvd

Timeline for d1wspc_:

• d1wspc_ first appeared in SCOP 1.75, called d1wspc1
  
• d1wspc_ appears in SCOPe 2.02
  
• d1wspc_ appears in the current release, SCOPe 2.08