SCOPe 2.01: Domain d1wspb_: 1wsp B:

Lineage for d1wspb_ (1wsp B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.8: DIX domain [159926] (1 protein)
   Pfam PF00778

6. Protein Axin 1 [159927] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [159928] (2 PDB entries)
   Uniprot O70239 745-827

8. Domain d1wspb_: 1wsp B: [145835]
   automated match to d1wspa1
   complexed with bez, hg

Details for d1wspb_

PDB Entry: 1wsp, 2.9 Å

PDB Description: Crystal structure of axin dix domain

PDB Compounds: (B:) Axin 1 protein

SCOPe Domain Sequences for d1wspb_:

Sequence; same for both SEQRES and ATOM records:

>d1wspb_ d.15.1.8 (B:) Axin 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pcdsivvayyfcgepipyrtlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfe
evredeailpvfeekiigkvekvd

Timeline for d1wspb_:

• d1wspb_ first appeared in SCOP 1.75, called d1wspb1
  
• d1wspb_ appears in SCOPe 2.02
  
• d1wspb_ appears in the current release, SCOPe 2.08