Lineage for d1wspb_ (1wsp B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933068Family d.15.1.8: DIX domain [159926] (2 proteins)
    Pfam PF00778
  6. 2933069Protein Axin 1 [159927] (1 species)
  7. 2933070Species Norway rat (Rattus norvegicus) [TaxId:10116] [159928] (2 PDB entries)
    Uniprot O70239 745-827
  8. 2933072Domain d1wspb_: 1wsp B: [145835]
    automated match to d1wspa1
    complexed with bez, hg

Details for d1wspb_

PDB Entry: 1wsp (more details), 2.9 Å

PDB Description: Crystal structure of axin dix domain
PDB Compounds: (B:) Axin 1 protein

SCOPe Domain Sequences for d1wspb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wspb_ d.15.1.8 (B:) Axin 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pcdsivvayyfcgepipyrtlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfe
evredeailpvfeekiigkvekvd

SCOPe Domain Coordinates for d1wspb_:

Click to download the PDB-style file with coordinates for d1wspb_.
(The format of our PDB-style files is described here.)

Timeline for d1wspb_: