SCOPe 2.06: Domain d1wrlc_: 1wrl C:

Lineage for d1wrlc_ (1wrl C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186813] (24 PDB entries)

8. Domain d1wrlc_: 1wrl C: [145827]
   automated match to d1ap4a_
   complexed with ca, tfp

Details for d1wrlc_

PDB Entry: 1wrl, 2.6 Å

PDB Description: crystal structure of the n-terminal domain of human cardiac troponin c in complex with trifluoperazine (monoclinic crystal form)

PDB Compounds: (C:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d1wrlc_:

Sequence; same for both SEQRES and ATOM records:

>d1wrlc_ a.39.1.5 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemid
evdedgsgtvdfdeflvmmvrsm

Timeline for d1wrlc_:

• d1wrlc_ first appeared in SCOP 1.75, called d1wrlc1
  
• d1wrlc_ appears in SCOPe 2.05
  
• d1wrlc_ appears in SCOPe 2.07
  
• d1wrlc_ appears in the current release, SCOPe 2.08