Lineage for d1wqha1 (1wqh A:2-184)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864674Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 864714Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (1 family) (S)
  5. 864715Family d.67.3.1: Ribosome recycling factor, RRF [55195] (1 protein)
  6. 864716Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 864727Species Mycobacterium tuberculosis [TaxId:1773] [160442] (3 PDB entries)
    Uniprot Q10794 2-184
  8. 864730Domain d1wqha1: 1wqh A:2-184 [145822]
    automatically matched to 1WQF A:2-184
    complexed with cd

Details for d1wqha1

PDB Entry: 1wqh (more details), 2.9 Å

PDB Description: Crystal structure of ribosome recycling factor from Mycobacterium tuberculosis
PDB Compounds: (A:) ribosome recycling factor

SCOP Domain Sequences for d1wqha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wqha1 d.67.3.1 (A:2-184) Ribosome recycling factor, RRF {Mycobacterium tuberculosis [TaxId: 1773]}
idealfdaeekmekavavarddlstirtgranpgmfsritidyygaatpitqlasinvpe
arlvvikpyeanqlraietairnsdlgvnptndgalirvavpqlteerrrelvkqakhkg
eeakvsvrnirrkameelhrirkegeagedevgraekdldktthqyvtqidelvkhkege
lle

SCOP Domain Coordinates for d1wqha1:

Click to download the PDB-style file with coordinates for d1wqha1.
(The format of our PDB-style files is described here.)

Timeline for d1wqha1: