Lineage for d1wqga_ (1wqg A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912596Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 1912641Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) (S)
    automatically mapped to Pfam PF01765
  5. 1912642Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)
  6. 1912671Protein automated matches [190814] (1 species)
    not a true protein
  7. 1912672Species Mycobacterium tuberculosis [TaxId:1773] [188088] (2 PDB entries)
  8. 1912673Domain d1wqga_: 1wqg A: [145821]
    automated match to d1wqfa1
    complexed with cd

Details for d1wqga_

PDB Entry: 1wqg (more details), 2.15 Å

PDB Description: Crystal structure of ribosome recycling factor from Mycobacterium Tuberculosis
PDB Compounds: (A:) ribosome recycling factor

SCOPe Domain Sequences for d1wqga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wqga_ d.67.3.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
idealfdaeekmekavavarddlstirtgranpgmfsritidyygaatpitqlasinvpe
arlvvikpyeanqlraietairnsdlgvnptndgalirvavpqlteerrrelvkqakhkg
eeakvsvrnirrkameelhrirkegeagedevgraekdldktthqyvtqidelvkhkege
llev

SCOPe Domain Coordinates for d1wqga_:

Click to download the PDB-style file with coordinates for d1wqga_.
(The format of our PDB-style files is described here.)

Timeline for d1wqga_: