Lineage for d1wqfa1 (1wqf A:2-184)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1030942Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 1030987Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (1 family) (S)
  5. 1030988Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)
  6. 1030989Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 1031000Species Mycobacterium tuberculosis [TaxId:1773] [160442] (1 PDB entry)
    Uniprot Q10794 2-184
  8. 1031001Domain d1wqfa1: 1wqf A:2-184 [145820]
    complexed with cd

Details for d1wqfa1

PDB Entry: 1wqf (more details), 2.65 Å

PDB Description: Crystal structure of Ribosome recycling factor from Mycobacterium Tuberculosis
PDB Compounds: (A:) ribosome recycling factor

SCOPe Domain Sequences for d1wqfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wqfa1 d.67.3.1 (A:2-184) Ribosome recycling factor, RRF {Mycobacterium tuberculosis [TaxId: 1773]}
idealfdaeekmekavavarddlstirtgranpgmfsritidyygaatpitqlasinvpe
arlvvikpyeanqlraietairnsdlgvnptndgalirvavpqlteerrrelvkqakhkg
eeakvsvrnirrkameelhrirkegeagedevgraekdldktthqyvtqidelvkhkege
lle

SCOPe Domain Coordinates for d1wqfa1:

Click to download the PDB-style file with coordinates for d1wqfa1.
(The format of our PDB-style files is described here.)

Timeline for d1wqfa1: