Class b: All beta proteins [48724] (177 folds) |
Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
Superfamily b.155.1: L21p-like [141091] (1 family) automatically mapped to Pfam PF00829 |
Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
Protein Ribosomal protein L21p [141093] (3 species) |
Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries) Uniprot P60492 1-101 |
Domain d1vspp1: 1vsp P:1-101 [145798] Other proteins in same PDB: d1vspa1, d1vspc1, d1vspf1, d1vspf2, d1vspi1, d1vspj1, d1vspo1, d1vsps1, d1vspt1, d1vspz1 |
PDB Entry: 1vsp (more details), 3.83 Å
SCOPe Domain Sequences for d1vspp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vspp1 b.155.1.1 (P:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]} mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg
Timeline for d1vspp1: