Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.24: Ribosomal protein L1 [56807] (1 superfamily) 2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1) |
Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) |
Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein) |
Protein Ribosomal protein L1 [56810] (4 species) |
Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries) |
Domain d1vspa1: 1vsp A:6-229 [145791] Other proteins in same PDB: d1vspc1, d1vspf1, d1vspf2, d1vspi1, d1vspj1, d1vspo1, d1vspp1, d1vsps1, d1vspt1, d1vspz1 automatically matched to 1YL3 C:5-228 |
PDB Entry: 1vsp (more details), 3.83 Å
SCOP Domain Sequences for d1vspa1:
Sequence, based on SEQRES records: (download)
>d1vspa1 e.24.1.1 (A:6-229) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]} kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsl phglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavg sklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppek ladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
>d1vspa1 e.24.1.1 (A:6-229) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]} kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsi efrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvyvtttmgps vrinphs
Timeline for d1vspa1: