Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (23 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
Protein Class alpha GST [81360] (8 species) |
Species Schistosoma japonicum [TaxId:6182] [52878] (12 PDB entries) Uniprot P08515 |
Domain d1u88b2: 1u88 B:5-81 [145783] Other proteins in same PDB: d1u88a1, d1u88b1 automatically matched to d2fhea2 complexed with gty; mutant |
PDB Entry: 1u88 (more details), 3.5 Å
SCOP Domain Sequences for d1u88b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u88b2 c.47.1.5 (B:5-81) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} lgfwkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidgdvk ltqsmaiiryiadkhnm
Timeline for d1u88b2: