SCOP 1.75: Domain d1u87a1: 1u87 A:82-208

Lineage for d1u87a1 (1u87 A:82-208)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [47633] (12 PDB entries)
   Uniprot P08515

8. Domain d1u87a1: 1u87 A:82-208 [145778]
   Other proteins in same PDB: d1u87a2
   automatically matched to d2fhea1
   complexed with gsw; mutant

Details for d1u87a1

PDB Entry: 1u87, 3.5 Å

PDB Description: crystal structure of the 26 kda glutathione s-transferase y7f mutant from schistosoma japonicum complexed with glutathione

PDB Compounds: (A:) Glutathione S-Transferase 26 kDa

SCOP Domain Sequences for d1u87a1:

Sequence; same for both SEQRES and ATOM records:

>d1u87a1 a.45.1.1 (A:82-208) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt
ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw
plqgwqa

Timeline for d1u87a1:

• d1u87a1 is new in SCOP 1.75
  
• d1u87a1 appears in SCOPe 2.01
  
• d1u87a1 appears in the current release, SCOPe 2.08